PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001308m
Common NameCARUB_v10001308mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 350aa    MW: 39241.6 Da    PI: 7.5655
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001308mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.8e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Carubv10001308m 15 KGLWSPEEDEKLLRYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding45.61.6e-1468111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Carubv10001308m  68 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 111
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-28765IPR009057Homeodomain-like
PROSITE profilePS5129425.6661066IPR017930Myb domain
SuperFamilySSF466898.8E-3013109IPR009057Homeodomain-like
SMARTSM007171.1E-131464IPR001005SANT/Myb domain
PfamPF002494.4E-161562IPR001005SANT/Myb domain
CDDcd001674.74E-121862No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2566117IPR009057Homeodomain-like
PROSITE profilePS5129420.79967117IPR017930Myb domain
SMARTSM007179.1E-1367115IPR001005SANT/Myb domain
PfamPF002492.0E-1368112IPR001005SANT/Myb domain
CDDcd001674.58E-970110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MMGRHSCCYK QKLRKGLWSP EEDEKLLRYI TKYGHGCWSS VPKQAGLQRC GKSCRLRWIN  60
YLRPDLKRGA FSQDEENLII ELHAVLGNRW SQIAAQLPGR TDNEIKNLWN SCLKKKLRLR  120
GIDPVTHKLL TEIESGTDDK PKPVEKSQQQ TYYHLVETEG SSSTTTCSTT TNQNNNNNNN  180
TDHLYTGNFG FQRLSIENGS RTATGSDLGI WIPQTGRNHH HVDENVPSAV VLPGSMFSSG  240
LTGYRSSNLG LIELENSFST GPMMTEQQQI QESNYNNNNS SAFFGAGNVN WGLTMDENQI  300
PFAISNHSNS SLYSDIKSET NFFGTEATNV GMWPICNQLQ AQQHAYGHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29131175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0545750.0AY054575.1 Arabidopsis thaliana Unknown protein (At4g01680; T15B16.4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288075.10.0hypothetical protein CARUB_v10001308mg
TrEMBLR0HBF40.0R0HBF4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__3543__AT4G01680.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.10.0myb domain protein 55